PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g10750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Dof
Protein Properties Length: 293aa    MW: 31707.2 Da    PI: 7.3089
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g10750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82.1e-3754107356
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrr 56 
                      +++lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+ 
  Vradi10g10750.1  54 QQTLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCS 107
                      7899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.4E-3255107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.85757111IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2458109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSGNCEKMVV IPSTTNQWPQ VDDHKVLMAS FGGSNNSKVM EKPDQELVQQ QLQQQTLKCP  60
RCDSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCSSDV NLPLFPRFGS  120
RISSSGFDLQ LNNALGLGFS SGVVSNEPSE NNSFRNGFGS NNALLSSYNS IFGSSSSSTS  180
TTPALSSLXS STLLQQKFIG SGLKDGADSN TFQHGLGLTP LEQXQMXSDN SEAGMVSLKD  240
VKVELGQNSR LEWNGACQNQ IQHVGMYDPS LYWXNSATAL GVWNDQAANI GS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517614.11e-173PREDICTED: dof zinc finger protein DOF1.4
TrEMBLV7BQA01e-172V7BQA0_PHAVU; Uncharacterized protein
STRINGGLYMA13G31100.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.26e-30Dof family protein